AV48196
Anti-CRYAB antibody produced in rabbit
IgG fraction of antiserum
Sinonimo/i:
Anti-CRYA2, Anti-CTPP2, Anti-Crystallin, α B, Anti-HSPB5
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.43
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
20 kDa
Reattività contro le specie
rat, mouse, human
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... CRYAB(1410)
Descrizione generale
Crystallin, α B (CRYAB) is a molecular chaperone that holds protein in soluble aggregates. It functions as a tumor suppressor by interacting with adherens junction to inhibit the progression of nasopharyngeal carcinoma. It is also known to inhibit stimulation of CD4+ T cells in relapsing-remitting multiple sclerosis patients.
Rabbit Anti-CRYAB antibody recognizes canine, rabbit, pig, human, mouse, rat, and bovine CRYAB.
Rabbit Anti-CRYAB antibody recognizes canine, rabbit, pig, human, mouse, rat, and bovine CRYAB.
Immunogeno
Synthetic peptide directed towards the C terminal region of human CRYAB
Applicazioni
Rabbit Anti-CRYAB antibody is suitable for western blot applications at a concentration of 5 μg/ml.
Azioni biochim/fisiol
Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy.
Sequenza
Synthetic peptide located within the following region: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
CRYAB modulates the activation of CD4+ T cells from relapsing-remitting multiple sclerosis patients.
Que Lan Quach et al.
Multiple sclerosis (Houndmills, Basingstoke, England), 19(14), 1867-1877 (2013-06-06)
Suppression of activation of pathogenic CD4(+) T cells is a potential therapeutic intervention in multiple sclerosis (MS). We previously showed that a small heat shock protein, CRYAB, reduced T cell proliferation, pro-inflammatory cytokine production and clinical signs of experimental allergic
Z Huang et al.
Oncogene, 31(32), 3709-3720 (2011-12-14)
Alpha B-crystallin (CRYAB) maps within the nasopharyngeal carcinoma (NPC) tumor-suppressive critical region 11q22-23 and its downregulation is significantly associated with the progression of NPC. However, little is known about the functional impact of CRYAB on NPC progression. In this study
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.