Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV46812

Sigma-Aldrich

Anti-RTN4 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-ASY, Anti-NI220/250, Anti-NOGO, Anti-NOGO-A, Anti-NOGOC, Anti-NSP, Anti-NSP-CL, Anti-Reticulon 4

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

42 kDa

Reattività contro le specie

human, rat, horse, mouse, sheep, pig, bovine, rabbit, dog

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_997403

N° accesso UniProt

Q9NQC3

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... RTN4(57142)

Immunogeno

Synthetic peptide directed towards the middle region of human RTN4

Applicazioni

Anti-RTN4 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mLl.

Azioni biochim/fisiol

RTN4 (reticulon 4) gene is a member of reticulon encoding genes family. It is expressed in oligodendrocytes and predominantly associates with the endoplasmic reticulum. It is a component of CNS white matter that inhibits the axonal regeneration and induces collapse in dorsal root ganglion growth cones. Beta-secretase beta-site APP cleaving enzyme 1 (BACE1), is a membrane-bound aspartyl protease that plays a pivotal role in the generation of amyloid beta-protein (Abeta). RTN4 interacts with BACE1 and blocks its activity.

Sequenza

Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC18323

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Kiyoko S Murayama et al.
The European journal of neuroscience, 24(5), 1237-1244 (2006-09-13)
Beta-secretase beta-site APP cleaving enzyme 1 (BACE1), is a membrane-bound aspartyl protease necessary for the generation of amyloid beta-protein (Abeta), which accumulates in the brains of individuals with Alzheimer's disease (AD). To gain insight into the mechanisms by which BACE1
T GrandPré et al.
Nature, 403(6768), 439-444 (2000-02-10)
Adult mammalian axon regeneration is generally successful in the peripheral nervous system (PNS) but is dismally poor in the central nervous system (CNS). However, many classes of CNS axons can extend for long distances in peripheral nerve grafts. A comparison
Min-Eun Park et al.
Vaccine, 32(40), 5221-5227 (2014-07-30)
The immunity and protective capability produced by vaccines can vary remarkably according to the kinds of adjuvants being used. In the case of foot-and-mouth disease (FMD) vaccines in pigs, only oil-adjuvant vaccines have been used, and these tend to show
Xuemei Chen et al.
Experimental neurology, 261, 267-277 (2014-07-30)
Yonkenafil is a novel phosphodiesterase type 5 (PDE5) inhibitor. Here we evaluated the effect of yonkenafil on ischemic injury and its possible mechanism of action. Male Sprague-Dawley rats underwent middle cerebral artery occlusion, followed by intraperitoneal or intravenous treatment with

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.