Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV46636

Sigma-Aldrich

Anti-TSPAN32 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-MGC22455, Anti-PHEMX, Anti-PHMX, Anti-TSSC6, Anti-Tetraspanin 32

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

31 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TSPAN32(10077)

Immunogeno

Synthetic peptide directed towards the middle region of human TSPAN32

Applicazioni

Anti-TSPAN32 (AB2) antibody produced in rabbit has been used for western blotting at a concentration of 5μg/ml. It has also been used for immunohistochemistry at a concentration of 4-8μg/ml.

Azioni biochim/fisiol

TSPAN32 encodes for tetraspanin 32 protein, that belongs to tetraspanin superfamily and is expressed mainly in hematopoietic tissues comprising peripheral blood leukocytes, thymus and spleen. It plays a crucial role in hematopoietic cell function. Additionally, it also facilitates the gulating T cell proliferation responses in vitro. TSSC6 along with CD37 regulates the antipathogen cellular immunity.

Sequenza

Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Kate H Gartlan et al.
Journal of immunology (Baltimore, Md. : 1950), 185(6), 3158-3166 (2010-08-17)
The cooperative nature of tetraspanin-tetraspanin interactions in membrane organization suggests functional overlap is likely to be important in tetraspanin biology. Previous functional studies of the tetraspanins CD37 and Tssc6 in the immune system found that both CD37 and Tssc6 regulate
L Robb et al.
Biochimica et biophysica acta, 1522(1), 31-41 (2001-11-24)
Previous analyses of the murine and human TSSC6 (also known as Phemx) proteins were not carried out using the full length sequence. Using 5'-RACE and cDNA library screening, we identified an additional 5' sequence for both the murine Tssc6 cDNA

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.