Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV45646

Sigma-Aldrich

Anti-NR4A3 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-CHN, Anti-CSMF, Anti-MINOR, Anti-NOR1, Anti-Nuclear receptor subfamily 4, group A, member 3, Anti-TEC

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

68 kDa

Reattività contro le specie

mouse, rat, rabbit, pig, human, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_008912

N° accesso UniProt

Q92570

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NR4A3(8013)

Immunogeno

Synthetic peptide directed towards the middle region of human NR4A3

Applicazioni

Anti-NR4A3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Azioni biochim/fisiol

Nuclear receptor subfamily 4, group A, member 3 (NR4A3; NOR1) is an orphan receptor belonging to the steroid-thyroid hormone-retinoid receptor superfamily. It binds the NGFI-B Response Element (NBRE) and acts as transcriptional activator. NR4A3 is a regulator of mast cell function, inflammation and insulin gene expression.

Sequenza

Synthetic peptide located within the following region: KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC13950

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Ankita Saini et al.
Scientific reports, 8(1), 2296-2296 (2018-02-06)
Mycobacterium tuberculosis instigates interactions with host factors to promote its survival within the host inimical conditions. Among such factors, nuclear receptors (NRs) seem to be promising candidates owing to their role in bacterial pathogenesis. However, only few members of NR
Gianni Garcia-Faroldi et al.
PloS one, 9(2), e89311-e89311 (2014-03-04)
Nuclear receptor 4a3 (Nr4a3) is a transcription factor implicated in various settings such as vascular biology and inflammation. We have recently shown that mast cells dramatically upregulate Nuclear receptor 4a3 upon activation, and here we investigated the functional impact of
Weina Gao et al.
PloS one, 9(3), e91462-e91462 (2014-03-19)
NR4A3/NOR-1 is a member of the NR4A orphan nuclear receptor subfamily, which contains early response genes that sense and respond to a variety of stimuli in the cellular environment. The role of NR4A3 in insulin expression in pancreatic beta cells
Takashi Nomiyama et al.
The Journal of biological chemistry, 281(44), 33467-33476 (2006-09-02)
Members of the nuclear hormone receptor superfamily function as key transcriptional regulators of inflammation and proliferation in cardiovascular diseases. In addition to the ligand-dependent peroxisome proliferator-activated receptors and liver X receptors, this family of transcription factors includes a large number
M Lappas
Placenta, 35(11), 866-875 (2014-09-10)
Members of the NR4A subfamily are involved in a wide range of diseases including obesity and diabetes. The aim of this study was to determine the effect of maternal obesity and gestational diabetes mellitus (GDM) on the expression of the

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.