Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV45004

Sigma-Aldrich

Anti-CRELD1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-AVSD2, Anti-CIRRIN, Anti-Cysteine-rich with EGF-like domains 1, Anti-DKFZP566D213

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

45 kDa

Reattività contro le specie

dog, guinea pig, bovine, horse, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CRELD1(78987)

Descrizione generale

Cysteine-rich with EGF-like domains 1 (CRELD1), a highly conserved membrane bound extracellular protein that defines a new epidermal growth factor-related gene family, is a cell adhesion molecule associated with cardiac atrioventricular septal defects (AVSD) and congenital heart disease (CHD).

Specificità

Anti-CRELD1 polyclonal antibody detects canine, human, bovine, mouse, and and rat cysteine-rich with EGF-like domains 1 proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of human CRELD1

Applicazioni

Anti-CRELD1 polyclonal antibody is used to tag cysteine-rich with EGF-like domains 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cysteine-rich with EGF-like domains 1 in cardiac diseases such as AVSD and CDH.

Azioni biochim/fisiol

Epidermal growth factor (EGF; MIM 131530)-like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Sequenza

Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.