AV43773

Anti-SLC10A5 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-P5, Anti-Solute carrier family 10 (sodium/bile acid cotransporter family), member 5
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Clone: polyclonal
• application: IHC; WB
• Reattività contro le specie: human
• tecniche: immunohistochemistry: suitable; western blot: suitable
• citations: 1

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 48 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_001010893
• N° accesso UniProt: Q5PT55
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... SLC10A5(347051)

Descrizione

Immunogeno

Synthetic peptide directed towards the C terminal region of human SLC10A5

Azioni biochim/fisiol

SLC10A5 is a member of solute carrier (SLC) family 10 of transporters involved in the influx of bile acids, steroidal hormones and various drugs. This member is particularly involved in the transport of solutes.

Sequenza

Synthetic peptide located within the following region: GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable