Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV40735

Sigma-Aldrich

Anti-PRPF6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-ANT-1, Anti-PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), Anti-TOM

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

104 kDa

Reattività contro le specie

dog, guinea pig, human, bovine, rabbit, mouse, rat, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PRPF6(24148)

Descrizione generale

PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) (PRPF6) is involved in pre-mRNA spliceosome assembly by acting as a link between small nuclear ribonucleoproteins (snRNP) U5 snRNP and U4/U6 snRNP to form U4/U6-U5 tri-snPNP. Mutation of PRPF6 are linked to impairment of pre-mRNA splicing and autosomal-dominant retinitis pigmentosa.

Specificità

Anti-PRPF6 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, zebrafish, and canine PRP6 pre-mRNA processing factor 6 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human PRPF6

Applicazioni

Anti-PRPF6 (AB2) polyclonal antibody is used to tag PRP6 pre-mRNA processing factor 6 homolog for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of PRP6 pre-mRNA processing factor 6 homolog in spliceosome assembly and autosomal-dominant retinitis pigmentosa.

Azioni biochim/fisiol

PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Sequenza

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Sylvie Bannwarth et al.
Brain : a journal of neurology, 137(Pt 8), 2329-2345 (2014-06-18)
Mitochondrial DNA instability disorders are responsible for a large clinical spectrum, among which amyotrophic lateral sclerosis-like symptoms and frontotemporal dementia are extremely rare. We report a large family with a late-onset phenotype including motor neuron disease, cognitive decline resembling frontotemporal

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.