AV38276

Anti-TEAD4 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-TEA domain family member 4
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 48 kDa
• Reattività contro le specie: rabbit, mouse, dog, human, guinea pig, rat, horse, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_003204
• N° accesso UniProt: Q96BK2
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TEAD4(7004)

Descrizione

Immunogeno

Synthetic peptide directed towards the C terminal region of human TEAD4

Azioni biochim/fisiol

TEAD4 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. TEAD4 is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. TEAD4 is encoded through the use of a non-AUG (TTG) translation initiation codon. This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. The protein is encoded through the use of a non-AUG (TTG) translation initiation codon. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Sequenza

Synthetic peptide located within the following region: MMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable