Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

AV35459

Sigma-Aldrich

Anti-KCNQ2 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Potassium voltage-gated channel, KQT-like subfamily, member 2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

43 kDa

Reattività contro le specie

human, horse, dog, mouse, bovine, guinea pig, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KCNQ2(3785)

Categorie correlate

Descrizione generale

Potassium voltage-gated channel subfamily Q member 2 (KCNQ2) gene, which codes for voltage-gated potassium channel subunits, is mostly expressed in the brain. KCNQ2 is made up of heteromultimeric channels with six transmembrane domains (S1–S6) in each subunit. It belongs to the voltage-gated potassium channels (KCNQ) gene subfamily. KCNQ2 gene is located on human chromosome 20q13.33.

Immunogeno

Synthetic peptide directed towards the middle region of human KCNQ2

Azioni biochim/fisiol

Potassium voltage-gated channel subfamily Q member 2 (KCNQ2) plays a vital role in neurodevelopment. Mutations in the KCNQ2 gene are associated with benign familial neonatal infantile seizures (BFNIS), benign familial neonatal convulsions (BFNC), benign familial infantile seizures (BFIS), and neonatal onset epileptic encephalopathy (EE).

Sequenza

Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Franchette T Pascual et al.
Epilepsy & behavior case reports, 1, 35-38 (2013-01-01)
Benign familial neonatal seizures (BFNS) is an autosomal dominant disorder associated with heterozygous mutations of either the KCNQ2 or KCNQ3 gene. Most cases have mutations of the KCNQ2 gene. A handful of cases with KCNQ2 and CHRNA4 deletions have been

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.