AV32564
Anti-FOXP1 antibody produced in rabbit
IgG fraction of antiserum
Sinonimo/i:
Anti-Forkhead box P1
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
75 kDa
Reattività contro le specie
horse, mouse, human, rabbit, rat, guinea pig
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... FOXP1(27086)
Categorie correlate
Descrizione generale
FOXP1 is a transcription regulator that is expressed in B cells. High levels of FOXP1 expression have been associated with poor prognosis in patients with diffuse large B-cell lymphomas (DLBCLs). Chromosomal aberrations in FOXP1 gene have been linked to mucosa-associated lymphoid tissue (MALT) lymphoma.
Rabbit Anti-FOXP1 antibody recognizes bovine, canine, chicken, human, mouse, and rat FOXP1.
Rabbit Anti-FOXP1 antibody recognizes bovine, canine, chicken, human, mouse, and rat FOXP1.
Immunogeno
Synthetic peptide directed towards the N terminal region of human FOXP1
Applicazioni
Rabbit Anti-FOXP1 antibody can be used for IHC (4-8μg/ml) and western blotting (0.5μg/ml) applications.
Azioni biochim/fisiol
FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).
Sequenza
Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Sharon L Barrans et al.
Blood, 104(9), 2933-2935 (2004-07-09)
FOXP1 (Forkhead box-P1) is a winged-helix transcription factor that is differentially expressed in resting and activated B cells. FOXP1 expression has been demonstrated in a subset of diffuse large B-cell lymphomas (DLBCLs) and is more common in the nongerminal center
B Streubel et al.
Leukemia, 19(4), 652-658 (2005-02-11)
The three chromosomal translocations t(11;18)(q21;q21), t(14;18)(q32;q21), and t(1;14)(p22;q32) are associated with MALT lymphoma. In a case of MALT lymphoma of the thyroid, we observed t(3;14)(p14.1;q32) by cytogenetic analysis. Fluorescence in situ hybridization studies showed that the immunoglobulin heavy chain locus
Guoxiao Guo et al.
Oncology letters, 12(2), 1554-1558 (2016-07-23)
The aim of the present study was to investigate the expression and function of forkhead box protein 3 (FOXP3) in gastric cancer using a rat model. A total of 92 Wistar rats were divided into two groups: An experimental group
Miaoxia He et al.
Gastric cancer : official journal of the International Gastric Cancer Association and the Japanese Gastric Cancer Association, 17(3), 431-441 (2013-11-16)
Mucosa-associated lymphoid tissue (MALT) lymphoma and diffuse large B-cell lymphoma (DLBCL), which are the two most common types of gastric lymphomas, have different clinicopathological features and molecular characteristics with distinct clinical outcomes. Tumor suppressor miR-34a connects the p53 network with
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.