AV32523

Anti-ZNF318 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Zinc finger protein 318
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 232 kDa
• Reattività contro le specie: human, horse, rat, mouse, bovine, dog, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_055160
• N° accesso UniProt: Q5VUA4
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ZNF318(24149)

Descrizione

Descrizione generale

ZNF318 is a zinc-finger protein that is upregulated during respiratory syncytial virus (RSV) infection in pharyngeal cells.
Rabbit Anti-ZNF318 recognizes mouse, canine, and human ZNF318.

Immunogeno

Synthetic peptide directed towards the N terminal region of human ZNF318

Applicazioni

Rabbit Anti-ZNF318 can be used for IHC (4-8μg/ml) and western blot (0.5μg/ml) applications.

Azioni biochim/fisiol

ZNF318 encodes a nuclear protein with a zinc finger motif of the Cys2-His2 type that is a novel corepressor of androgen receptor (AR).

Sequenza

Synthetic peptide located within the following region: SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable