Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

AV32186

Sigma-Aldrich

Anti-KLF3 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Kruppel-like factor 3 (basic)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

39 kDa

Reattività contro le specie

rabbit, guinea pig, horse, human, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_057615

N° accesso UniProt

P57682

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KLF3(51274)

Descrizione generale

KLF3 is a transcriptional factor that regulates muscle-specific genes. It is known to interact with serum response factor (SRF) through KLF binding sites.
Rabbit Anti-KLF3 antibody recognizes canine, human, mouse, rat, pig, chicken, and bovine KLF3.

Immunogeno

Synthetic peptide directed towards the N terminal region of human KLF3

Applicazioni

Rabbit Anti-KLF3 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Azioni biochim/fisiol

KLF3 is a zinc finger transcription factor that is known to function as a potent transcriptional repressor

Sequenza

Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Charis L Himeda et al.
Molecular and cellular biology, 30(14), 3430-3443 (2010-04-21)
This study identifies KLF3 as a transcriptional regulator of muscle genes and reveals a novel synergistic interaction between KLF3 and serum response factor (SRF). Using quantitative proteomics, KLF3 was identified as one of several candidate factors that recognize the MPEX
Agnes Fütterer et al.
Cell death & disease, 12(7), 637-637 (2021-06-23)
Embryonic stem cell (ESC) differentiation and somatic cell reprogramming are biological processes governed by antagonistic expression or repression of a largely common set of genes. Accurate regulation of gene expression is thus essential for both processes, and alterations in RNA

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.