Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV32134

Sigma-Aldrich

Anti-MyF5 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Myogenic factor 5

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

28 kDa

Reattività contro le specie

goat, rat, guinea pig, bovine, sheep, horse, mouse, human, rabbit

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MYF5(4617)

Descrizione generale

MyF5 (MyoD) regulates the determination of skeletal myoblasts during embryonic development. Inactivation of MyF5 in mice results in abnormal development of the ribs, which eventually leads to perinatal death.
Rabbit Anti-MyF5 antibody recognizes chicken, pig, human, mouse, rat, and bovine MyF5.

Immunogeno

Synthetic peptide directed towards the N terminal region of human MYF5

Applicazioni

Rabbit Anti-MyF5 antibody can be used for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

MYF5 is a member of the myogenic basic helix-loop-helix family of transcription factors, which can activate the muscle differentiation program.

Sequenza

Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

M A Rudnicki et al.
Cell, 75(7), 1351-1359 (1993-12-31)
Mice carrying null mutations in the myogenic regulatory factors Myf-5 or MyoD have apparently normal skeletal muscle. To address whether these two factors functionally substitute for one another in myogenesis, mice carrying mutant Myf-5 and MyoD genes were interbred. While
T Braun et al.
Cell, 71(3), 369-382 (1992-10-30)
The Myf-5 gene, a member of the myogenic basic HLH factor family, has been inactivated in mice after homologous recombination in ES cells. Mice lacking Myf-5 were unable to breathe and died immediately after birth, owing to the absence of

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.