Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV32048

Sigma-Aldrich

Anti-CNOT2 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-CCR4-NOT transcription complex, subunit 2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

40 kDa

Reattività contro le specie

dog, rabbit, mouse, bovine, human, rat, horse, guinea pig

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CNOT2(4848)

Descrizione generale

CNOT2 forms a part of the transcriptional regulator, the Ccr4-Not complex, and can repress promoter functions. Studies have reported that depletion of CNOT2 inhibits CCR4-NOT deadenylase and causes apoptosis in cells. Furthermore, the SMRT/NCoR-HDAC3 complex is known to be a cofactor of CNOT2-mediated transcriptional repression.
Rabbit Anti-CNOT2 antibody recognizes bovine, human, mouse, rat, canine, and chicken CNOT2.

Immunogeno

Synthetic peptide directed towards the middle region of human CNOT2

Applicazioni

Rabbit Anti-CNOT2 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Azioni biochim/fisiol

CNOT2 is one of the subunits of the CCR4-NOT complex,which functions as general transcription regulation complex.

Sequenza

Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Kentaro Ito et al.
Genes to cells : devoted to molecular & cellular mechanisms, 16(4), 368-379 (2011-02-09)
Eukaryotic mRNA decay is initiated by shortening of the poly (A) tail; however, neither the molecular mechanisms underlying deadenylation nor its regulation is well understood. The human CCR4-NOT complex is a major cytoplasmic deadenylase consisting of a combination of at
Carin G M Zwartjes et al.
The Journal of biological chemistry, 279(12), 10848-10854 (2004-01-07)
The evolutionary conserved Ccr4-Not complex controls mRNA metabolism at multiple levels in eukaryotic cells. Genetic analysis of not mutants in yeast identifies a negative role in transcription, which is dependent on core promoter structure. To obtain direct support for this
Sandrine Jayne et al.
The Biochemical journal, 398(3), 461-467 (2006-05-23)
In eukaryotic cells, the Ccr4-Not complex can regulate mRNA metabolism at various levels. Previously, we showed that promoter targeting of the CNOT2 subunit resulted in strong repression of RNA polymerase II transcription, which was sensitive to the HDAC (histone deacetylase)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.