AV31259
Anti-CEBPB antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-CCAAT/enhancer binding protein (C/EBP), β
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
36 kDa
Reattività contro le specie
dog, guinea pig, human, bovine
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
Informazioni sul gene
human ... CEBPB(1051)
Descrizione generale
CEBPB is a hepatic transcription factor that contains the basic leucine zipper (bZIP) domain. This transcription factor is known to interact with genes involved in acute phase response, metabolic activities, homeostatic functions, and the progression of cell cycle.
Rabbit Anti-CEBPB antibody binds to bovine, human, and pig CEBPB.
Rabbit Anti-CEBPB antibody binds to bovine, human, and pig CEBPB.
Immunogeno
Synthetic peptide directed towards the C terminal region of human CEBPB
Applicazioni
Rabbit Anti-CEBPB antibody can be used for western blot applications at 0.5μg/ml.
Azioni biochim/fisiol
The protein encoded by this intronless gene, CEBPB, is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene.
Sequenza
Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Janus Schou Jakobsen et al.
Genome research, 23(4), 592-603 (2013-02-14)
Dynamic shifts in transcription factor binding are central to the regulation of biological processes by allowing rapid changes in gene transcription. However, very few genome-wide studies have examined how transcription factor occupancy is coordinated temporally in vivo in higher animals.
Fen Wang et al.
Hypertension (Dallas, Tex. : 1979), 63(2), 281-288 (2013-11-06)
DNA methylation patterns are maintained in adult somatic cells. Recent findings, however, suggest that all methylation patterns are not preserved. We demonstrate that stimulatory signals can change the DNA methylation status at a CCAAT/enhancer binding protein (CEBP) binding site and
Philip D Campbell et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(44), 14717-14732 (2014-10-31)
Mutations in Kinesin proteins (Kifs) are linked to various neurological diseases, but the specific and redundant functions of the vertebrate Kifs are incompletely understood. For example, Kif5A, but not other Kinesin-1 heavy-chain family members, is implicated in Charcot-Marie-Tooth disease (CMT)
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.