Passa al contenuto
Merck
Tutte le immagini(3)

Key Documents

AV100604

Sigma-Aldrich

Anti-ETS1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

50 kDa

Reattività contro le specie

dog, guinea pig, goat, rat, rabbit, human, bovine, mouse, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_001137292

N° accesso UniProt

P14921

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ETS1(2113)

Descrizione generale

ETS1 belongs to the Ets family of transcription factors that are crucial mediators of extracellular matrix remodeling. The Ets family members are regulators of bone and cartilage development.

Immunogeno

Synthetic peptide directed towards the N terminal region of human ETS1

Applicazioni

Anti-ETS1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Azioni biochim/fisiol

The DNA-binding activity of ETS1 requires the phosphorylation at Thr38 by ERK1/2. ETS1 is expressed in a variety of cell types including hematopoietis cells, endothelial cells, epithelial cancer cells and vascular smooth muscle cells. ETS1 promotes cell invasion and angiogenesis as it regulates the transcription of VEGF and MMP genes.

Sequenza

Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Y Sato
Cell structure and function, 26(1), 19-24 (2001-05-10)
The ETS family of transcription factors is defined by a conserved DNA-binding ETS domain that forms a winged helix-turn-helix structural motif. This family of transcription factors is involved in a diverse array of biological functions including cellular growth and differentiation
Jürgen Dittmer
Molecular cancer, 2, 29-29 (2003-09-16)
The Ets1 proto-oncoprotein is a member of the Ets family of transcription factors that share a unique DNA binding domain, the Ets domain. The DNA binding activity of Ets1 is controlled by kinases and transcription factors. Some transcription factors, such
M Trojanowska
Oncogene, 19(55), 6464-6471 (2001-02-15)
Ets factors are critical mediators of extracellular matrix (ECM) remodelling. As the spectrum of Ets-regulated target genes widens, so does their role in various pathological and physiological processes. Regulation of matrix degrading proteases by Ets factors in tumor invasion and
A Raouf et al.
Oncogene, 19(55), 6455-6463 (2001-02-15)
Bone formation in vivo is a complex phenomenon whereby recruitment and replication of mesenchymal precursors of osteoblasts, differentiation into preosteoblasts, osteoblasts, and mature osteoblasts ultimately result in the accumulation and mineralization of the extracellular matrix. MC3T3-E1, a clonal osteoblastic cell
Hung-Fu Liao et al.
Development (Cambridge, England), 141(12), 2402-2413 (2014-05-23)
The ability of adult stem cells to reside in a quiescent state is crucial for preventing premature exhaustion of the stem cell pool. However, the intrinsic epigenetic factors that regulate spermatogonial stem cell quiescence are largely unknown. Here, we investigate
Visualizza tutti i documenti correlati

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.