Passa al contenuto
Merck
Tutte le immagini(5)

Documenti fondamentali

AMAB90854

Sigma-Aldrich

Monoclonal Anti-RHOT1 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL1095, purified immunoglobulin, buffered aqueous glycerol solution

Sinonimo/i:

ARHT1, FLJ11040, MIRO-1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

CL1095, monoclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

tecniche

immunohistochemistry: 1:200- 1:500

Isotipo

IgG1

N° accesso Ensembl | uomo

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... RHOT1(55288)

Descrizione generale

Miro1/RHOT1 (ras homolog family member T1) is an outer mitochondrial membrane (OMM) protein. It has a transmembrane domain, two GTPase domains and two Ca2+-sensing EF-hand domains. RHOT1 is located on human chromosome 17q11.

Immunogeno

ras homolog family member T1, recombinant protein epitope signature tag (PrEST)

Sequence
THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE

Epitope
Binds to an epitope located within the peptide sequence ERTDKDSRLP as determined by overlapping synthetic peptides.

Applicazioni

Monoclonal Anti-RHOT1 antibody has been used in Immunoprecipitation.

Azioni biochim/fisiol

Miro1/RHOT1 (ras homolog family member T1) regulates mitochondrial trafficking and distribution. The Rho GTPase Miro-1 plays a crucial role in the modulation of mitochondrial morphogenesis and acts as a calcium-dependent sensor for the control of mitochondrial motility.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71907

Stato fisico

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

K27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase.
Birsa N, et al.
The Journal of Biological Chemistry, jbc-M114 (2014)
K27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase.
Birsa N, et al.
Test, jbc-M114 (2014)
Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity
Morlino G, et al.
Molecular and Cellular Biology, MCB-01177 (2014)
Evidence-based genomic diagnosis characterized chromosomal and cryptic imbalances in 30 elderly patients with myelodysplastic syndrome and acute myeloid leukemia
Bajaj R, et al.
Molecular Cytogenetics, 4(1), 3-3 (2011)
Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity
Morlino G, et al.
Molecular and cellular biology, MCB-01177 (2014)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.