5096
CD86 human
recombinant, expressed in E. coli, 0.5 mg protein/mL
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352200
NACRES:
NA.75
Prodotti consigliati
Origine biologica
human
Ricombinante
expressed in E. coli
Descrizione
0.1 mg recombinant human CD86 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
Sterilità
Filtered sterilized solution
Saggio
≥90% (SDS-PAGE)
Stato
liquid
Confezionamento
pkg of 100 μg
Concentrazione
0.5 mg protein/mL
Numero d’accesso
NP_008820
N° accesso UniProt
Temperatura di conservazione
−20°C
Informazioni sul gene
human ... CD86(942)
Applicazioni
Coating a plate well (6 well plate) with this recombinant CD86 protein in T cell specific medium at 1-10 μg/well allows for use as 1) a coating matrix protein for human T cell/ receptor interaction or as a highly purified recombinant antigen or 2) as a culture matrix protein for T cell differentiation regulation studies in vitro.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD86 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2. Add appropriate amount of diluted material to culture surface.
3. Incubate at room temperature for approximately 1.5 hours.
4. Aspirate remaining material.
5. Rinse plates carefully with water and avoid scratching bottom surface of plates.
6. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD86 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2. Add appropriate amount of diluted material to culture surface.
3. Incubate at room temperature for approximately 1.5 hours.
4. Aspirate remaining material.
5. Rinse plates carefully with water and avoid scratching bottom surface of plates.
6. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Sequenza
MASMTGGQQMGRGHHHHHHGNLYFQGGEFELPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Nota sulla preparazione
The full-length extracellular domain of the human CD86 gene (24 - 247 aa, Isoform-2) was constructed with 31 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 2
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Ci dispiace, ma al momento non ci sono COA disponibili online per questo prodotto.
Se ti serve aiuto, non esitare a contattarci Servizio Clienti
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Emmanuelle Benard et al.
Frontiers in immunology, 9, 2085-2085 (2018-10-04)
We created APC-mimetic synthetic substrates to study the impact of ligand clustering on T cell activation and spreading. The substrates exhibit antibodies directed against the TCR-complex in the form of a patterned array of sub micrometric dots surrounded by a
Valentine V Courouble et al.
Journal of the American Society for Mass Spectrometry, 32(7), 1618-1630 (2021-06-15)
Coronavirus (CoV) nonstructural proteins (nsps) assemble to form the replication-transcription complex (RTC) responsible for viral RNA synthesis. nsp7 and nsp8 are important cofactors of the RTC, as they interact and regulate the activity of RNA-dependent RNA polymerase and other nsps.
Pedro Morgado et al.
Infection and immunity, 79(11), 4401-4412 (2011-09-14)
Toxoplasma gondii is a globally distributed parasite pathogen that infects virtually all warm-blooded animals. A hallmark of immunity to acute infection is the production of gamma interferon (IFN-γ) and interleukin-12 (IL-12), followed by a protective T cell response that is
Omar S Qureshi et al.
Science (New York, N.Y.), 332(6029), 600-603 (2011-04-09)
Cytotoxic T lymphocyte antigen 4 (CTLA-4) is an essential negative regulator of T cell immune responses whose mechanism of action is the subject of debate. CTLA-4 shares two ligands (CD80 and CD86) with a stimulatory receptor, CD28. Here, we show
Alia M Aldahlawi et al.
BMC complementary medicine and therapies, 20(1), 352-352 (2020-11-21)
Boswellia sacra resin has been commonly used as analgesic, antimicrobial, and anti-inflammatory properties, which reflect its immunomodulatory activity. Dendritic cells (DCs) are specialized antigen-presenting cells (APCs) and sentinel cells that regulate the immune response. This study aims at investigating whether
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.