SAB5702269

Anti-CD68 Antibody, clone 5S2F7, Rabbit Monoclonal

• Synonyme(s) : CD68,GP110,LAMP4,SCARD1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 5S2F7, monoclonal
• Forme: liquid
• Poids mol.: 80-130 kDa
• Espèces réactives: human, rat, rat
• Concentration: 1 mg/mL
• Technique(s): flow cytometry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK
• Numéro d'accès UniProt: P34810
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CD68(968)

Description

Description générale

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Application

WB, FC

Informations sur la sécurité

• Pictogrammes: GHS07,GHS09
• Mention d'avertissement: Warning
• Mentions de danger: H317,H411
• Conseils de prudence: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classification des risques: Aquatic Chronic 2 - Skin Sens. 1
• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3