SAB5702151

Anti-Integrin alpha V (ITGAV/CD51) Antibody, clone 10T9N2, Rabbit Monoclonal

• Synonyme(s) : CD51,MSK8,VNRA,VTNR,Integrin alpha V,ITGAV
• Code UNSPSC : 12352203

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 10T9N2, monoclonal
• Forme: liquid
• Poids mol.: 140 kDa
• Espèces réactives: rat, human, rat
• Concentration: 1 mg/mL
• Technique(s): flow cytometry: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
• Numéro d'accès UniProt: P06756
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ITGAV(3685)

Description

Description générale

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V (ITGAV/CD51) (NP_002201.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC, FC

Informations sur la sécurité

• Pictogrammes: GHS07,GHS09
• Mention d'avertissement: Warning
• Mentions de danger: H317 - H411
• Conseils de prudence: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classification des risques: Aquatic Chronic 2 - Skin Sens. 1
• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3