Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

MSST0037

Sigma-Aldrich

SILuProt IGFBP7 Insulin-like growth factor-binding protein 7 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Synonyme(s) :

IBP-7, IGF-binding protein 7, IGF-bindingprotein7, IGFBP-7, IGFBP-rP1, MAC25 protein, PGI2-stimulating factor, Prostacyclin-stimulating factor, Tumor-derived adhesion factor (TAF)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.12

Source biologique

human

Niveau de qualité

Produit recombinant

expressed in HEK 293 cells

Pureté

≥98% (SDS-PAGE)

Forme

lyophilized powder

Puissance

≥98 Heavy amino acids incorporation efficiency by MS

Technique(s)

mass spectrometry (MS): suitable

Adéquation

suitable for mass spectrometry (standard)

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... IGFBP7(3490)

Description générale

IGFBP7 regulates the availability of insulin-like growth factors (IGFs) in tissue, and modulates IGF binding to its receptors. IGFBP7 binds to IGF with high affinity. Several studies have shown the involvement of IGFBP7 in Acute Kidney Injury (AKI), where its levels can predict patients at risk for developing AKI. When combined with TIMP-2, the accuracy of AKI risk prediction is further increased. Urinary [TIMP-2]×[IGFBP7] test sufficiently detects patients with risk of AKI after major non-cardiac surgery. In addition, Urinary [TIMP-2]×[IGFBP7] serves as a sensitive and specific biomarker to predict AKI early after cardiac surgery and to predict renal recovery.

Immunogène

HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Actions biochimiques/physiologiques

SILuProt IGFBP7 is a recombinant, stable isotope-labeled human IGFBP7 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IGFBP7 in mass-spectrometry. SILu Prot IGFBP7 is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa.

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique