HPA015325
Anti-CDK17 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-PCTAIRE- motif protein kinase 2, Anti-PCTK2 antibody produced in rabbit, Anti-Serine/threonine-protein kinase PCTAIRE-2
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
Séquence immunogène
RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... PCTK2(5128)
Catégories apparentées
Description générale
CDK17 (cyclin-dependent kinase 17) belongs to a subfamily of Cdc2-related kinases, and is exclusively expressed in brain. It is expressed usually in post-mitotic cells. In brains, it has predominant expression in olfactory bulb and hippocampus, which are generally made of post-mitotic neurons. This gene is localized to human chromosome 12q23.1, which codes for a protein composed of 523 amino acids, and has a molecular weight of 60kDa. It contains a central kinase domain and one N- and C-terminal domain each.
Immunogène
Serine/threonine-protein kinase PCTAIRE-2 recombinant protein epitope signature tag (PrEST)
Application
Anti-CDK17 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Actions biochimiques/physiologiques
CDK17 (cyclin-dependent kinase 17) acts as a serine/threonine kinase, and phosphorylates histone H1. It is an interacting partner of Trap (tudor repeat associator with PCTAIRE 2), and it interacts with it through its N-terminal.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST73465
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Adam R Cole
Neuro-Signals, 17(4), 288-297 (2009-10-10)
PCTAIRE kinases (PCTKs) are highly conserved serine/threonine kinases that are closely related to cyclin-dependent kinases. They are enriched in post-mitotic neurons of adult brains, suggesting they might perform important neuron-specific functions independent of the cell cycle. So far, the biological
T Hirose et al.
European journal of biochemistry, 267(7), 2113-2121 (2000-03-23)
PCTAIRE 2 is a Cdc2-related kinase that is predominantly expressed in the terminally differentiated neuron. To elucidate the function of PCTAIRE 2, proteins that associate with PCTAIRE 2 were screened by the yeast two-hybrid system. A positive clone was found
Time-resolved dissection of early phosphoproteome and ensuing proteome changes in response to TGF-β.
Rochelle C J D'Souza et al.
Science signaling, 7(335), rs5-rs5 (2014-07-25)
Transforming growth factor-β (TGF-β) signaling promotes cell motility by inducing epithelial-to-mesenchymal transitions (EMTs) in normal physiology and development, as well as in pathological conditions, such as cancer. We performed a time-resolved analysis of the proteomic and phosphoproteomic changes of cultured
T Hirose et al.
European journal of biochemistry, 249(2), 481-488 (1997-11-25)
PCTAIRE are members of a subfamily of Cdc2-related kinases that have been shown to be preferentially expressed in post-mitotic cells. To examine the neural functions of PCTAIRE, rat cDNA clones encoding PCTAIRE 1, 2, and 3 were isolated, and their
Time-resolved dissection of early phosphoproteome and ensuing proteome changes in response to TGF-?.
D'Souza RC, Knittle AM, Nagaraj N, et al.
Science Signaling, 7(335), rs5-rs5 (2014)
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique