Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

HPA014600

Sigma-Aldrich

Anti-MARCH1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-E3 ubiquitin-protein ligase MARCH1, Anti-MARCH- I, Anti-Membrane-associated RING finger protein 1, Anti-Membrane-associated RING-CH protein I, Anti-RING finger protein 171

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:50- 1:200

Séquence immunogène

KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MARCH1(55016)

Description générale

MARCH1 (membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase) is a member of MARCH family of E3 ubiquitin ligases. This family is RING-v type ligases and has 11 members. Most proteins of this family have RING domain in their cytosolic N-terminal, and two transmembrane regions. MARCH1 is generally expressed on secondary lymphoid tissues, such as B-cells and dendritic cells. It is localized to plasma membrane and endosomes.

Immunogène

E3 ubiquitin-protein ligase MARCH1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

MARCH1 (membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase) is involved in the maturation of dendritic cells. Its under-expression leads to stable surface expression of major histocompatibility (MHC) II, on dendritic cells. Its expression also determines the fate of CD98, post its endocytosis; whether CD98 is degraded or recycled. It is also capable of dimerization and auto-ubiquitination, thus, controlling its own expression. In antigen presenting cells (APCs), its expression is induced by interleukin (IL)-10, which leads to the suppression of MHCII expression. IL-10 is a strong anti-inflammatory cytokine and thus, MARCH1 plays a role in the suppression of immune response. It regulates the cell surface expression of its substrates such as, tumor necrosis factor-related apoptosis inducing ligand (TRAIL) receptor 1. It ubiquitinates and degrades TRAIL-R1, and maintains its steady state expression.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST72906

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Marie-Claude Bourgeois-Daigneault et al.
Journal of immunology (Baltimore, Md. : 1950), 188(10), 4959-4970 (2012-04-18)
Some members of the membrane-associated RING-CH family of E3 ubiquitin ligases (MARCHs) are membrane-bound and target major players of the immune response. MARCH1 ubiquitinates and downregulates MHC class II expression in APCs. It is induced by IL-10 and despite a
Jacques Thibodeau et al.
European journal of immunology, 38(5), 1225-1230 (2008-04-05)
IL-10 is a potent anti-inflammatory cytokine interfering with antigen presentation by inducing the intracellular sequestration of MHC class II (MHC-II) molecules. Here we studied the contribution of membrane-associated RING-CH (MARCH) ubiquitin ligase family members to the IL-10-induced down-regulation of MHC-II
Craig A Eyster et al.
Molecular biology of the cell, 22(17), 3218-3230 (2011-07-16)
Following endocytosis, internalized plasma membrane proteins can be recycled back to the cell surface or trafficked to late endosomes/lysosomes for degradation. Here we report on the trafficking of multiple proteins that enter cells by clathrin-independent endocytosis (CIE) and determine that
Bert van de Kooij et al.
The Journal of biological chemistry, 288(9), 6617-6628 (2013-01-10)
The eleven members of the membrane-associated RING-CH (MARCH) ubiquitin ligase family are relatively unexplored. Upon exogenous (over)expression, a number of these ligases can affect the trafficking of membrane molecules. However, only for MARCH-1 endogenous functions have been demonstrated. For the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique