AV48793

Anti-POLK antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-DINB1, Anti-DINP, Anti-POLQ, Anti-Polymerase (DNA directed) kappa
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 99 kDa
• Espèces réactives: mouse, rat, dog, pig, bovine, horse, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_057302
• Numéro d'accès UniProt: Q9UBT6
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... POLK(51426)

Description

Description générale

POLK codes for polymerase (DNA directed) κ that facilitates DNA-damage bypass via the extension step of lesion bypass. POLK promoter is negatively regulated by p53.
Rabbit Anti-POLK antibody recognizes human, mouse, rat, canine, and bovine POLK.

Immunogène

Synthetic peptide directed towards the middle region of human POLK

Application

Rabbit Anti-POLK antibody is suitable for western blot applications at a concentration of 1μg/ml.

Actions biochimiques/physiologiques

POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. It lacks 3′-5′ proofreading exonuclease activity. POLK forms a Schiff base with 5′-deoxyribose phosphate at abasic sites, but does not have lyase activity.

Séquence

Synthetic peptide located within the following region: ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable