Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV46636

Sigma-Aldrich

Anti-TSPAN32 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-MGC22455, Anti-PHEMX, Anti-PHMX, Anti-TSSC6, Anti-Tetraspanin 32

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

31 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_620591

Numéro d'accès UniProt

Q96QS1-2

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TSPAN32(10077)

Immunogène

Synthetic peptide directed towards the middle region of human TSPAN32

Application

Anti-TSPAN32 (AB2) antibody produced in rabbit has been used for western blotting at a concentration of 5μg/ml. It has also been used for immunohistochemistry at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

TSPAN32 encodes for tetraspanin 32 protein, that belongs to tetraspanin superfamily and is expressed mainly in hematopoietic tissues comprising peripheral blood leukocytes, thymus and spleen. It plays a crucial role in hematopoietic cell function. Additionally, it also facilitates the gulating T cell proliferation responses in vitro. TSSC6 along with CD37 regulates the antipathogen cellular immunity.

Séquence

Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Kate H Gartlan et al.
Journal of immunology (Baltimore, Md. : 1950), 185(6), 3158-3166 (2010-08-17)
The cooperative nature of tetraspanin-tetraspanin interactions in membrane organization suggests functional overlap is likely to be important in tetraspanin biology. Previous functional studies of the tetraspanins CD37 and Tssc6 in the immune system found that both CD37 and Tssc6 regulate
L Robb et al.
Biochimica et biophysica acta, 1522(1), 31-41 (2001-11-24)
Previous analyses of the murine and human TSSC6 (also known as Phemx) proteins were not carried out using the full length sequence. Using 5'-RACE and cDNA library screening, we identified an additional 5' sequence for both the murine Tssc6 cDNA

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique