AV45680

Anti-KNG1 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-BDK, Anti-KNG, Anti-Kininogen 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 72 kDa
• Espèces réactives: human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_001095886
• Numéro d'accès UniProt: P01042
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... KNG1(3827)

Description

Description générale

Kininogen 1 (KNG1) a precursor of the kinin has recently been identified as possible biomarkers for chronic hepatitis C and proliferative vitreoretinopathy (PVR).

Spécificité

Anti-KNG1 polyclonal antibody reacts with human and mouse kininogen 1 proteins.

Immunogène

Synthetic peptide directed towards the middle region of human KNG1

Application

Anti-KNG1 polyclonal antibody is used to tag kininogen 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of kininogen 1 as a potential biomarker for chronic hepatitis C and proliferative vitreoretinopathy (PVR).

Actions biochimiques/physiologiques

Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.

Séquence

Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable