WH0004609M2

Monoclonal Anti-MYC antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-cMyc, Anti-v-Myc myelocytomatosis viral oncogene homolog (avian)
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1G7, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG3κ
• GenBank-Hinterlegungsnummer: NM_002467
• UniProt-Hinterlegungsnummer: P01106
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MYC(4609)

Beschreibung

Allgemeine Beschreibung

MYC (MYC proto-oncogene) is a transcriptional factor and oncoprotein. c-myc is a member of MYC gene family. It is located on human chromosome 8q24. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor.

The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-terminal. The synthesis of non-AUG initiated protein is suppressed in Burkitt′s lymphomas, suggesting its importance in the normal function of this gene. (provided by RefSeq)

Immunogen

MYC (NP_002458, 330 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Biochem./physiol. Wirkung

The cellular myelocytomatosis (c-myc) oncogene plays a major role in cellular proliferation, differentiation and apoptosis. It acts as transcriptional regulator of gene expression. MYC (MYC proto-oncogene) may be essential for cancer initiation, promotion and therapy resistance. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)