WH0003290M2

Monoclonal Anti-HSD11B1 antibody produced in mouse

clone 2C10, ascites fluid

• Synonym(e): Anti-11DH, Anti-11betaHSD1, Anti-HDL, Anti-HSD11, Anti-HSD11B, Anti-HSD11L, Anti-MGC13539, Anti-hydroxysteroid (11-beta) dehydrogenase 1
• MDL-Nummer: MFCD08064405
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: ascites fluid
• Antikörper-Produkttyp: primary antibodies
• Klon: 2C10, monoclonal
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotyp: IgMκ
• GenBank-Hinterlegungsnummer: BC012593
• UniProt-Hinterlegungsnummer: P28845
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HSD11B1(3290)

Beschreibung

Allgemeine Beschreibung

The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Immunogen

HSD11B1 (AAH12593, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Physikalische Form

Solution

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)