SAB5702089

Anti-hnRNP E1/PCBP1 Antibody, clone 7M1K0, Rabbit Monoclonal

• Synonym(e): PCBP1, HEL-S-85, HNRPE1, HNRPX, hnRNP-E1, hnRNP-X, poly(rC)-binding protein 1
• UNSPSC-Code: 12352203
• NACRES: NA.46

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Materialien: colorless
• Klon: 7M1K0, monoclonal
• Form: liquid
• Mol-Gew.: 40 kDa
• Speziesreaktivität: human, rat, rat
• Konzentration: 0.5 mg/mL
• Methode(n): western blot: 1:500 - 1:2000
• Farbe: colorless
• Isotyp: IgG
• Immunogene Sequenz: MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL
• UniProt-Hinterlegungsnummer: Q15365
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PCBP1(5093)

Beschreibung

Allgemeine Beschreibung

This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP E1/PCBP1 (Q15365).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Anwendung

WB

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1