SAB2104747

Anti-METTL3 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-M6A, Anti-MGC4336, Anti-MT-A70, Anti-Spo8
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 64 kDa
• Speziesreaktivität: human, mouse, rabbit, horse, rat, guinea pig, dog, bovine
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NM_019852
• UniProt-Hinterlegungsnummer: Q86U44
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... METTL3(56339)

Beschreibung

Allgemeine Beschreibung

Methyltransferase like 3 (METTL3), an RNA methyltransferase, is a member of the class I methyltransferase (MTase) family and contains the MTase domain. The METTL3 gene is mapped to human chromosome 14q11.2.

Immunogen

Synthetic peptide directed towards the middle region of human METTL3

Anwendung

Anti-METTL3 antibody produced in rabbit has been used in western blotting.

Biochem./physiol. Wirkung

Methyltransferase like 3 (METTL3) is part of methyltransferase systems that mediates the m⁶methyladenosine modifications. It exists as a heterodimeric complex with METTL14. An elevated expression of METTL3 is observed in clear cell renal cell carcinoma and rheumatoid arthritis (RA). Mutations in the METTL3 gene are implicated in autoimmune thyroid disease (AITD) and neuroblastoma. It may function as a tumor-suppresser in colorectal cancer.

Sequenz

Synthetic peptide located within the following region: IVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLD

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable