SAB1403990

Monoclonal Anti-IRF4, (C-terminal) antibody produced in mouse

clone 2D1, purified immunoglobulin, buffered aqueous solution

• Synonym(e): LSIRF, MUM1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2D1, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~38.21 kDa
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• NCBI-Hinterlegungsnummer: NM_002460
• UniProt-Hinterlegungsnummer: Q15306
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... IRF4(3662)

Beschreibung

Allgemeine Beschreibung

Interferon regulatory factor 4 (IRF4), also known as multiple myeloma oncogene-1 (MUM1), is a transcription factor. It is encoded by the gene mapped to human chromosome 6p25.3. The protein is specifically expressed in lymphocytes.

Immunogen

IRF4 (NP_002451, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Biochem./physiol. Wirkung

Interferon regulatory factor 4 (IRF4) plays a vital role in regulation of immunoglobulin class switch recombination and plasma cell differentiation. In addition, it is also implicated in maintaining homeostasis of both mature B and mature T lymphocytes. Mutation in the gene is associated with the risk of developing chronic lymphocytic leukemia (CLL).

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable