SAB1403531

Monoclonal Anti-JAG1 antibody produced in mouse

clone 1B7, purified immunoglobulin, buffered aqueous solution

• Synonym(e): AGS, AHD, AWS, CD339, HJ1, JAGL1, MGC104644
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1B7, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~38.1 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• NCBI-Hinterlegungsnummer: NM_000214
• UniProt-Hinterlegungsnummer: P78504
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... JAG1(182)

Beschreibung

Allgemeine Beschreibung

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis. (provided by RefSeq)

Immunogen

JAG1 (NP_000205, 905 a.a. ~ 1014 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHV

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable