SAB1402692

Monoclonal Anti-APOC3, (C-terminal) antibody produced in mouse

clone 8H7, purified immunoglobulin, buffered aqueous solution

• Synonym(e): APOCIII, MGC150353
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 8H7, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~34.8 kDa
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_000040
• UniProt-Hinterlegungsnummer: P02656
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... APOC3(345)

Beschreibung

Allgemeine Beschreibung

Apolipoprotein C3 (APOC3) is a 79 amino acid protein with a molecular weight of 8.8kDa. It is present on high density, low density and triglyceride-rich lipoproteins. The gene encoding this protein is localized on human chromosome 11q23.3.

Immunogen

APOC3 (NP_000031.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Biochem./physiol. Wirkung

Apolipoprotein C3 (APOC3) is involved in the metabolism of triglyceride-rich lipoproteins. It may have a role in atherosclerosis. The protein stimulates hypertriglyceridemia (HTG) by inhibiting the activity of lipoprotein lipase and interfering with the binding of APOB or APOE to hepatic receptors. It also promotes very low density lipoprotein (VLDL) assembly and secretion in the liver.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable