MSST0006

SILu^™Lite VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Synonym(e): SILuLite Vascular endothelial growth factor A
• UNSPSC-Code: 23201100
• NACRES: NA.12

Eigenschaften

• Biologische Quelle: human
• Qualitätsniveau: 200
• Rekombinant: expressed in HEK 293 cells
• Assay: ≥98% (SDS-PAGE)
• Form: lyophilized powder
• Methode(n): mass spectrometry (MS): suitable
• UniProt-Hinterlegungsnummer: P15692
• Lagertemp.: −20°C
• Angaben zum Gen: human ... VEGFA(7422)

Beschreibung

Allgemeine Beschreibung

SILu^™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.


Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Biochem./physiol. Wirkung

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.¹ VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.²
VEGF has also been implicated in correlation with poor prognosis in breast cancer.² In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)^3,4

Sequenz

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Physikalische Form

Supplied as a lyophilized powder containing phosphate buffered saline

Rechtliche Hinweise

SILu is a trademark of Sigma-Aldrich Co. LLC

Sicherheitshinweise

• Lagerklassenschlüssel: 11 - Combustible Solids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable