Direkt zum Inhalt
Merck

HPA044653

Sigma-Aldrich

Anti-SPI1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-OF, Anti-PU.1, Anti-SFPI1, Anti-SPI-1, Anti-SPI-A

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

Immunogene Sequenz

EDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEG

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... SPI1(6688)

Allgemeine Beschreibung

Spi-1 proto-oncogene (SPI1), also called PU.1, belongs to E26 transformation-specific (ETS) transcription factor family and is highly expressed in hematopoietic stem cells. SPI1 gene is mapped to human chromosome 11p11.2. It has N-terminal transcriptional activation domain with acidic amino acid sub domains, a central proline, glutamic acid, serine, and threonine-rich (PEST) region and a C-terminal ETS domain.

Immunogen

Spi-1 proto-oncogene

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Spi-1 proto-oncogene (SPI1) mediates transcriptional regulation by DNA binding and protein interactions via its ETS domain. SPI1 is crucial for the fetal lymphoid and myeloid differentiation. PU.1 interaction with GFI-1 (growth factor independence-1) is essential for macrophage granulocyte development. High expression of Spi1 leads to senescence in erythroid progenitors and is regarded as critical step to target leukemia. It also interacts with microRNA, miR-424 and modulates macrophage differentiation. Deletions in the SPI1 gene is implicated in acute myeloid leukemia (AML). SPI1 gene inactivation results in fetal death.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST84738

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Inactivation of PU. 1 in adult mice leads to the development of myeloid leukemia
Metcalf D, et al.
Proceedings of the National Academy of Sciences of the USA, 103(5), 1486-1491 (2006)
Dynamic regulation of PU. 1 expression in multipotent hematopoietic progenitors
Nutt SL, et al.
The Journal of Experimental Medicine, 201(2), 221-231 (2005)
The transcriptional repressor GFI-1 antagonizes PU. 1 activity through protein-protein interaction
Dahl R, et al.
The Journal of Biological Chemistry, 282(9), 6473-6483 (2007)
Heterozygous deletion of the PU. 1 locus in human AML
Bonadies N, et al.
Blood, 115(2), 331-334 (2010)
Senescence is a Spi1/PU. 1-induced anti-proliferative mechanism in primary hematopoietic cells
Delestre L, et al.
Haematologica, 102(11), 1850?1860-1850?1860 (2017)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.