HPA015768

Anti-S100B antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Protein S100-B, Anti-S-100 protein beta chain, Anti-S-100 protein subunit beta, Anti-S100 calcium-binding protein B
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA015768
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:1000-1:2500
• Immunogene Sequenz: LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
• UniProt-Hinterlegungsnummer: P04271
• Anwendung(en): research pathology
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... S100B(6285)

Beschreibung

Allgemeine Beschreibung

S100B is a Ca²⁺ binding protein that is secreted by the astrocytes by an autocrine pathway to activate the release of nitric oxide. S100B may regulate the functions of microglial cells . It may also be associated with the dynamics of intermediary filaments and microtubules in glial cells . Anti-S100B antibodies are specific for S100B in humans. The gene encoding S100B is localized on human chromosome 21.

Immunogen

Protein S100-B recombinant protein epitope signature tag (PrEST)

Anwendung

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunocytochemistry (1 paper)
Immunofluorescence (1 paper)
Immunohistochemistry (1 paper)

Biochem./physiol. Wirkung

S-100 β subunit (S100B) exerts paracrine and autocrine effects on neurons and glia. At nanomolar concentrations, the encoded protein promotes neurite outgrowth and increases survival of neurons during development. S100B serves as a marker of melanocyte cytotoxicity. In addition, it also acts as a serum marker in endocrine resistant breast cancer and nonsegmental vitiligo. Decreased expression of S100B has been observed in chronic liver disease patients.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73328

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)