HPA010957

Anti-NRG4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Pro-NRG4 antibody produced in rabbit, Anti-Pro-neuregulin-4, membrane-bound isoform antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA010957
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:20- 1:50
• Immunogene Sequenz: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK
• UniProt-Hinterlegungsnummer: Q8WWG1
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NRG4(145957)

Beschreibung

Allgemeine Beschreibung

NRG4 (neuregulin 4) belongs to a family of epidermal growth factors (EGFs), which in human has four members, from NRG1- NRG4. It is a transmembrane protein containing 115 amino acids, and has an EGF domain. The EGF domain is located at the N-terminal, which also contains one N-linked glycosylation site. This protein contains another isoform called NRG4A2, which contains a putative type I PDZ-binding peptide, in the C-terminal. NRG4 has limited expression in adult tissues and is not expressed in brain. Both the isoforms of NRG4, NRG4A1 and NRG4A2, are expressed on the surface of the cell, where NRG4A2 is found in punctate membrane regions and NRG4A1 resides at membrane ruffles.

Immunogen

Pro-neuregulin-4, membrane-bound isoform recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

NRG4 (neuregulin 4) binds exclusively to and activates ERBB4 (erb-b2 receptor tyrosine kinase 4), and therefore, might play a role in mediating the ERBB4 related cellular responses. For instance, the interaction of NRG4 with ERBB4 induces survival pathway in colon epithelial cells. Expression of NRG4 and its receptor ERBB4 is related to better prognosis and survival rates in patients with bladder cancer. This gene is up-regulated in prostate cancer, and its overexpression is correlated to the advanced-stage of prostate cancer. It is a brown adipose tissue (BAT)-enriched secreted factor that suppresses lipogenic signaling in liver, and maintains lipid and glucose homeostasis in obese individuals. Aberrant NRG4 signaling might be implicated in the pathogenesis of non-alcoholic fatty liver disease (NAFLD) and type 2 diabetes.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72227

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)