C4874

Calmodulin bovine

recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE)

• Synonym(e): CaM, Phosphodiesterase 3:5-cyclic nucleotide activator, Phosphodiesterase 3′:5′-cyclic nucleotide activator
• MDL-Nummer: MFCD00131869
• UNSPSC-Code: 12352202
• NACRES: NA.26

Eigenschaften

• Biologische Quelle: bovine
• Qualitätsniveau: 200
• Rekombinant: expressed in E. coli
• Assay: ≥98% (SDS-PAGE)
• Form: lyophilized powder
• Mol-Gew.: M_w 19000.9 by amino acid sequence
• Zusammensetzung: Protein, ≥85%
• UniProt-Hinterlegungsnummer: P62157
• Lagertemp.: −20°C
• Angaben zum Gen: bovine ... CALM(100297344)

Beschreibung

Allgemeine Beschreibung

Calmodulin from bovine takes up a dumb-bell-structure. Two calcium binding EF hand loops, antiparallel β-sheet and three α-helices comprises a lobe. It has a central helix connecting the lobes. Calmodulin can bind four calcium molecules in a cooperative interaction pattern.

Anwendung

Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease Glu-C proteolysis and deamidation studies.

Biochem./physiol. Wirkung

Ca²⁺ binding protein that is required for activation of cyclic nucleotide-dependent phosphodiesterase. It is also a cofactor/activator of nitric oxide synthase, calcineurin, and many kinases including ATPase, myosin light chain kinase, and CAM kinase I, II, and III. It mediates ryanodine receptor activation by cyclic ADP-ribose and is involved in intracellular Ca²⁺ homeostasis.

Calmodulin from bovine undergoes conformational changes upon calcium binding. It binds to sphingosylphosphorylcholine and inhibit calcineurin and phosphodiesterase enzymes.

Physikalische Eigenschaften

Sequence:
MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Angaben zur Herstellung

Produced using animal component-free materials.

Sicherheitshinweise

• Lagerklassenschlüssel: 11 - Combustible Solids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable