AV48268

Anti-PRDX6 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-1-Cys, Anti-AOP2, Anti-AiPLA2, Anti-KIAA0106, Anti-MGC46173, Anti-NSGPx, Anti-PRX, Anti-Peroxiredoxin 6
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 25 kDa
• Speziesreaktivität: horse, bovine, rat, rabbit, dog, human, mouse, guinea pig, sheep
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_004896
• UniProt-Hinterlegungsnummer: P30041
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PRDX6(9588)

Beschreibung

Allgemeine Beschreibung

Peroxiredoxin 6 (PRDX6) is a thiol-specific antioxidant protein that acts as a bifunctional enzyme. It is involved in modulating the susceptibility of beta cells to oxidative stress. Prdx6 deficiency has been linked to impaired homeostasis and cell death/apoptosis. It has also been implicated in papillary thyroid carcinomas.
Rabbit Anti-PRDX6 antibody recognizes pig, bovine, human, mouse, rat, chicken, and zebrafish PRDX6.

Immunogen

Synthetic peptide directed towards the C terminal region of human PRDX6

Anwendung

Rabbit Anti-PRDX6 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem./physiol. Wirkung

PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequenz

Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable