Accéder au contenu
MilliporeSigma
Toutes les photos(6)

Principaux documents

WH0007528M1

Sigma-Aldrich

Monoclonal Anti-YY1 antibody produced in mouse

clone 2C4, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-DELTA, Anti-NFE1, Anti-UCRBP, Anti-YINYANG1, Anti-YY1 transcription factor

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2C4, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... YY1(7528)

Description générale

The gene YY1 (Yin Yang 1) encodes a protein belonging to the GLI-Krüppel gene family. It is a zinc finger protein that is ubiquitously expressed. The YY1 gene is mapped to human chromosome 14q32.

Immunogène

YY1 (NP_003394, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH

Application

Monoclonal Anti-YY1 antibody produced in mouse has been used in immunohistochemistry.

Actions biochimiques/physiologiques

YY1 (Yin Yang 1) is a transcriptional repressor protein encoded by the YY1 gene in humans. It regulates diverse biological processes and may have an important role in carcinogenesis. Its expression is found to be upregulated in gastric cancer cell lines and primary gastric cancers. YY1 is found to contribute to carcinogenesis in gastric cancer. This DNA-binding protein is found to regulate the activity of the c-fos promoter. YY1 has roles in cell proliferation, differentiation, apoptosis and cell cycle progression.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Expression of YY1 in Differentiated Thyroid Cancer
Jessica Arribas
Endocrine Pathology (2015)
DNA bending and orientation-dependent function of YY1 in the c-fos promoter
S Natesan
Genes & Development, 7 (1993)
Transcriptional repression by YY1, a human GLI-Kruppel-related protein, and relief of repression by adenovirus E1A protein
Y Shi
Cell, 34 (2009)
Transcription factor YY1 expression in human gastrointestinal cancer cells
Dharmaraj Chinnappan
International Journal of Oncology, 34 (2009)
YY1 DNA binding and interaction with YAF2 is essential for Polycomb recruitment
Arindam Basu
Nucleic Acids Research, 42 (2013)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique