SAB2108476

Anti-c-Myc Tag Antibody

rabbit polyclonal

• Synonyme(s) : Anti- MRTL, Anti- bHLHe39, Anti-c-Myc
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• product name: Anti-MYC, affinity isolated antibody
• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 50 kDa
• Espèces réactives: guinea pig, mouse, rabbit, human, rat
• Concentration: 0.5-1 mg/mL
• Technique(s): immunoblotting: suitable; immunohistochemistry: suitable
• Numéro d'accès: NM_002467
• Numéro d'accès UniProt: P01106
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MYC(4609)

Description

Description générale

The cellular myelocytomatosis (c-myc) gene mapped to human chromosome 8q24, is the cellular homologue of the v-myc gene originally isolated from an avian myelocytomatosis virus. c-myc is a member of MYC gene family. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that regulates the G1-S cell cycle transition.

Immunogène

Synthetic peptide directed towards the N terminal region of human MYC

Actions biochimiques/physiologiques

The cellular myelocytomatosis (c-myc) oncogene plays a vital role in cellular proliferation, differentiation, apoptosis and acts as transcriptional regulator of gene expression. c-Myc expression is essential and sufficient to assist most of the cells to enter synthetic (S) phase of the cell cycle. The encoded protein plays a crucial role in vasculogenesis and angiogenesis during cancer development and progression. c-Myc interacts with its binding partner Max and activates the transcription of growth promoting genes such as cyclin D2, ornithine decarboxylase and E2F1 and it also represses the transcription of multiple genes, especially p21 and p27, by binding to the transcription initiator element (Inr) in a complex with Max and either Sp1 or Miz1. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).

Séquence

Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable