Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

SAB2104741

Sigma-Aldrich

Anti-MRPL37, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-MGC878, Anti-MRPL2, Anti-RPML2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

48 kDa

Espèces réactives

rat, horse, bovine, human, rabbit, mouse, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NM_016491

Numéro d'accès UniProt

Q9BZE1

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... MRPL37(51253)

Description générale

The gene MRPL37 (mitochondrial ribosomal protein L37) is mapped to human chromosome 1p32.3. The gene encodes a mitochondrial ribosomal protein of the large subunit. The MRPL37 protein associates with MTO1 (mitochondrial translation optimization factor 1), a regulator of mitochondrial translation.

Immunogène

Synthetic peptide directed towards the N terminal region of human MRPL37

Séquence

Synthetic peptide located within the following region: VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sex-specific regulation of mitochondrial DNA levels: genome-wide linkage analysis to identify quantitative trait loci.
Lopez S
PLoS ONE, 7, e42711-e42711 (2012)
MTO1 mediates tissue specificity of OXPHOS defects via tRNA modification and translation optimization, which can be bypassed by dietary intervention.
Tischner C
Human Molecular Genetics, 24, 2247-2266 (2015)
Reconstructing the evolution of the mitochondrial ribosomal proteome.
Smits P
Nucleic Acids Research, 35, 4686-4703 (2007)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique