SAB2104260

Anti-EBF2 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-COE2, Anti-EBF-2, Anti-FLJ11500, Anti-O/E-3, Anti-OE-3
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 63 kDa
• Espèces réactives: bovine, horse, human, rabbit, mouse, rat, guinea pig, dog
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NM_022659
• Numéro d'accès UniProt: Q9HAK2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... EBF2(64641)

Description

Immunogène

Synthetic peptide directed towards the middle region of human EBF2

Actions biochimiques/physiologiques

EBF2 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors.EBF2 belongs to the conserved Olf/EBF family (see MIM 164343) of helix-loop-helix transcription factors (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-103 AU120738.1 302-404 104-650 AL701879.1 1-547 651-735 AC090103.4 79460-79544 736-796 BC069665.1 1-61 797-1794 BC074794.2 1-998 1795-2297 AK021562.1 1082-1584

Séquence

Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable