Accéder au contenu
MilliporeSigma
Toutes les photos(10)

Key Documents

HPA006385

Sigma-Aldrich

Anti-UBTF antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-NOR-90, Anti-UBF, Anti-UBF1, Anti-UBF2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

RNAi knockdown
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... UBTF(7343)

Description générale

UBTF (upstream binding transcription factor) is composed of six HMG box domains, which are lined up consecutively. It also contains a dimerization and a transactivation domain. It has two isoforms- UBF1 and UBF2. It is also called NOR (nucleolus organizer region)-90, and is a member of the NOR family, which is a family of ribosomal genes. It is highly expressed in human fetus. This gene is localized to human chromosome 17q21.3.

Immunogène

Nucleolar transcription factor 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-UBTF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

UBTF (upstream binding transcription factor) or NOR-90 is a transcriptionally competent NOR as it is active during interphase. It serves as a scaffold to conform chromatin in a transcriptionally favorable condition. It is involved in the transcription of rDNA (ribosomal DNA), when it interacts with Pol I (RNA polymerase 7) enzyme. Along with SL1 (selectivity factor 1) complex, it binds to the enhancer region of rDNA. It acts as a negative regulator of Herpes simplex virus 1 (HSV-1) replication, where it suppresses the expression of viral DNA. It plays a role in tissue development and leukemia development.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70888

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Margarita Sobol et al.
Nucleus (Austin, Tex.), 4(6), 478-486 (2014-02-12)
To maintain growth and division, cells require a large-scale production of rRNAs which occurs in the nucleolus. Recently, we have shown the interaction of nucleolar phosphatidylinositol 4,5-bisphosphate (PIP2) with proteins involved in rRNA transcription and processing, namely RNA polymerase I
Nigel D Stow et al.
The Journal of general virology, 90(Pt 1), 69-73 (2008-12-18)
Previous reports have shown that adenovirus recruits nucleolar protein upstream-binding factor (UBF) into adenovirus DNA replication centres. Here, we report that despite having a different mode of viral DNA replication, herpes simplex virus type 1 (HSV-1) also recruits UBF into
Markéta Kalmárová et al.
Journal of structural biology, 163(1), 40-44 (2008-05-27)
Ribosomal genes are organized in clusters termed Nucleolus Organizer Regions (NORs). Essential components of the RNA polymerase I transcription machinery, including Upstream Binding Factor (UBF), can be detected on some NORs during mitosis; these NORs, termed competent, are believed to
J He et al.
Folia biologica, 54(6), 202-206 (2008-01-01)
During Pol I-mediated rRNA synthesis, UBF plays a key role in transcription. Numerous localization studies provided, however, rather divergent results with regard to its presence in either of the two structural nucleolar subcompartments, FC and DFC. These observations suggest different
A G Matera et al.
Genomics, 41(1), 135-138 (1997-04-01)
The 90-kDa nucleolus organizer region autoantigen (NOR-90) was previously shown to be identical to human upstream binding factor (hUBF), which has two molecular mass forms of 89 and 93 kDa, respectively. hUBF/NOR-90 is a member of the HMG-box DNA-binding protein

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique