AV42553

Anti-AKR1B10 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-AKR1B11, Anti-AKR1B12, Anti-ALDRLn, Anti-ARL-1, Anti-ARL1, Anti-Aldo-keto reductase family 1, member B10 (aldose reductase), Anti-HIS, Anti-HSI
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 35 kDa
• Espèces réactives: rabbit, human, dog, yeast, horse, mouse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_064695
• Numéro d'accès UniProt: O60218
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... AKR1B10(57016)

Description

Description générale

Aldo-keto reductase family 1B10 (AKR1B10) exhibits restricted lipid substrate specificity including farnesal, geranylgeranial, retinal and carbonyls; wherein metabolizing these lipid substrates has a crucial role in promoting carcinogenesis. AKR1B10 and 1B12 display high catalytic efficiency with all-trans-retinaldehyde. Aldo-keto reductase 1B10 (AKR1B10) is a secretory protein that is upregulated with tumorigenic transformation of human mammary epithelial cells. It is a tumor marker for cancers such as pancreatic cancer, lung carcinomas.

Spécificité

Anti-AKR1B10 polyclonal antibody reacts with human, mouse, rat, and zebrafish aldo-keto reductase family 1, member B10 (aldose reductase) enzymes..

Immunogène

Synthetic peptide directed towards the N terminal region of human AKR1B10

Application

Anti-AKR1B10 polyclonal antibody is used to tag advanced AKR1B10 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a potential tumor marker for pancreatic and lung cancer.

Actions biochimiques/physiologiques

AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Séquence

Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable