AV32612
Anti-TBX21 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-HGNC:11599, Anti-T-PET, Anti-T-bet, Anti-T-box Transcription factor, Anti-TBLYM
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
58 kDa
Espèces réactives
pig, dog, bovine, human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
immunohistochemistry: suitable
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... TBX21(30009)
Description générale
Rabbit polyclonal anti-TBX21 antibody reacts with canine, bovine, pig, human, mouse, and rat T-box transcription factor 21 transcription factors.
T-box genes encode transcription factors that regulate developmental processes. T-box transcription factor 21 (TBX21) is the human ortholog of mouse Tbx21/Tbet, a lineage commitment regulator for the differentiation of interferon-gamma (IFNG) producting CD4 T helper (Th1) 1 cells.
TBX21 is involved in the development of T-lymphocytes. Functional TBX21 variations have been associated with aspirin-induced asthmaand have been linked to clinical outcomes for inhaled corticosteroid therapy in asthma patients.
Immunogène
Synthetic peptide directed towards the middle region of human TBX21
Application
Rabbit Anti-TBX21 antibody can be used for western blot applications at a concentration of 1.0-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
Rabbit polyclonal anti-TBX21 antibody is used to tag T-box 21 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of T-box transcription factor 21 in the differentiation of interferon-gamma (IFNG) producting CD4 T helper 1 (Th1) cells.
Actions biochimiques/physiologiques
TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.
Séquence
Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Mitsuteru Akahoshi et al.
Human genetics, 117(1), 16-26 (2005-04-05)
Asthma is a phenotypically heterogeneous disorder with many etiologic factors and clinical characteristics. T-bet, a Th1-specific transcription factor of T-box family, has been found to control interferon-gamma (IFN-gamma) expression in T cells. Mice lacking the T-bet gene (tbx21) demonstrate multiple
Kelan G Tantisira et al.
Proceedings of the National Academy of Sciences of the United States of America, 101(52), 18099-18104 (2004-12-18)
TBX21 encodes for the transcription factor T-bet (T-box expressed in T cells), which influences naive T lymphocyte development and has been implicated in asthma pathogenesis. Specifically, the T-bet knockout mouse spontaneously develops airway hyperresponsiveness and other changes consistent with asthma.
Judy T Tellam et al.
PLoS pathogens, 10(10), e1004423-e1004423 (2014-10-10)
Recent studies have shown that virally encoded mRNA sequences of genome maintenance proteins from herpesviruses contain clusters of unusual structural elements, G-quadruplexes, which modulate viral protein synthesis. Destabilization of these G-quadruplexes can override the inhibitory effect on self-synthesis of these
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique