Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV32060

Sigma-Aldrich

Anti-PCSK6 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Proprotein convertase subtilisin/kexin type 6

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

68 kDa

Espèces réactives

rabbit, dog, horse, human, mouse, pig, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PCSK6(5046)

Description générale

PCSK6 is a proprotein convertase that processes inactive protein into their active forms. PCSK6 has been linked to handedness in dyslexic individuals and has also been implicated in malignant gliomas.
Rabbit Anti-PCSK6 antibody recognizes human, mouse, rat, and canine PCSK6.

Immunogène

Synthetic peptide directed towards the N terminal region of human PCSK6

Application

Rabbit Anti-PCSK6 antibody can be used for western blot applications at a concentration of 2.5μg/ml.

Actions biochimiques/physiologiques

PCSK6 is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. This gene is thought to play a role in tumor progression.

Séquence

Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

S Delic et al.
Neuropathology and applied neurobiology, 38(2), 201-212 (2011-07-05)
The molecular mechanisms underlying the infiltrative growth of glioblastomas, the most common primary tumours of the central nervous system in adults, are still poorly understood. We aimed to identify and functionally validate novel glioma invasion-associated candidate genes. Microarray-based expression analysis
Thomas S Scerri et al.
Human molecular genetics, 20(3), 608-614 (2010-11-06)
Approximately 90% of humans are right-handed. Handedness is a heritable trait, yet the genetic basis is not well understood. Here we report a genome-wide association study for a quantitative measure of relative hand skill in individuals with dyslexia [reading disability
Ying Wang et al.
The Journal of endocrinology, 222(1), 151-160 (2014-05-27)
Mammalian proprotein convertases (PCs) play an important role in folliculogenesis, as they proteolytically activate a variety of substrates such as the transforming growth factor beta (TGFβ) superfamily. PC subtilism/kexin 6 (PCSK6) is a member of the PC family and is

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique