AV31648

Anti-LASS3 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-LAG1 homolog, ceramide synthase 3 (S. cerevisiae)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 46 kDa
• Espèces réactives: human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_849164
• Numéro d'accès UniProt: Q8IU89
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... LASS3(204219)

Description

Description générale

Longevity assurance homologue 3 (LASS3) is a testis-specific (dihyrdo)ceramide synthase that acts on a broad range of substrates. LASS3 is known to have two transcriptional variants, comprising of a 384-amino acid protein and a 419-amino acid protein.
Rabbit Anti-LASS3 antibody recognizes zebrafish, chicken, human, mouse, rat, bovine, and canine LASS3.

Immunogène

Synthetic peptide directed towards the N terminal region of human LASS3

Application

Rabbit Anti-LASS3 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Actions biochimiques/physiologiques

The gene encoding the hypothetical protein LASS3 is located on chromosome 15.

Séquence

Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable