Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV37106

Sigma-Aldrich

Anti-NFATC2 antibody produced in rabbit

IgG fraction of antiserum

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

100 kDa

species reactivity

mouse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

mouse ... NFATC2(18019)

General description

Nuclear factor of activated T-cells, cytoplasmic 2(NFATC2) is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). Upon T cell receptor (TCR) stimulation, NFATC2 gets translocated from the cytoskeleton to the nucleus where it becomes a component of the the nuclear factors of activated T cells transcription complex. It plays a role in regulating expression of genes critical for cell cycle progression during lymphocyte activation.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse NFATC2

Biochem/physiol Actions

NFATC2 is a member of The NF-AT family of potent transcription factors that are essential for T cell activation

Sequence

Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mauricio S Caetano et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 16(14), 1940-1942 (2002-10-09)
Upon antigen stimulation, lymphocytes enter in cell cycle and proliferate, and most of the activated T cells die by apoptosis. Many of the proteins that regulate lymphocyte activation are Under the control of transcription factors belonging to the NFAT family.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service