WH0157285M1

Monoclonal Anti-DKFZp761P0423 antibody produced in mouse

clone 5C6, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-hypothetical protein DKFZp761P0423
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 5C6, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: XM_291277
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PRAGMIN(157285)

Descrição

Descrição geral

The gene encoding homolog of rat pragma of Rnd2 (SGK223) or PRAGMIN is located on human chromosome 8p23.1.

Imunogênio

DKFZp761P0423 (XP_291277, 2 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTE

Ações bioquímicas/fisiológicas

Homolog of rat pragma of Rnd2 (SGK223) or PRAGMIN binds to the C-terminal Src kinase (CSK) and prevents its movement from the cytoplasm to the cell membrane.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)